2,170 research outputs found
Resonance for Singular Perturbation Problems
Consider the resonance for a second-order equation εy"-xpy’+ qy = 0. Another proof is given for the necessity of the Matkowsky condition and the connection with a regular eigenvalue problem is established. Also, if p, q are analytic, necessary and sufficient conditions are derived
Numerical Methods for Singular Perturbation Problems
Consider the two-point boundary value problem for a stiff system of ordinary differential equations. An adaptive method to solve these problems even when turning points are present is discussed
Ein weiterer Fundort von Cicindela germanica L. 1758 (Coleoptera: Cicindelidae) aus Ostwestfalen
Autoren älterer Arbeiten melden die Art des öfteren als zahlreich, sehr häufig oder auch massenhaft auftretend (WESTHOFF 1881 , VERHOEFF 1890, ROETTGEN 1911, HORION 1941 u.a.). Gleichzeitig wird aber auch betont, daß so häufiges Auftreten lokal beschränkt ist und die Art auch in weiten Gebieten fehlt. In jüngeren Arbeiten wird von einem Rückgang oder gar vom Aussterben in den ehemaligen Vorkommensgebieten berichtet (BARNER 1937, HORION 1941). Wegen der Seltenheit der Nachweise in der zweiten Hälfte dieses Jahrhunderts und des allgemeinen Rückgangs der Art, soll hier ein jüngerer Nachweis bekannt gemacht werden: Am 7.6.1981 sah ich ein Exemplar im Naturschutzgebiet "Stockberg" bei Höxter-Ottbergen
On the well posedness of Robinson Trautman Maxwell solutions
We show that the so called Robinson-Trautman-Maxwell equations do not
constitute a well posed initial value problem. That is, the dependence of the
solution on the initial data is not continuous in any norm built out from the
initial data and a finite number of its derivatives. Thus, they can not be used
to solve for solutions outside the analytic domain.Comment: 9 page
Metallic phase of disordered graphene superlattices with long-range correlations
Using the transfer matrix method, we study the conductance of the chiral
particles through a monolayer graphene superlattice with long-range correlated
disorder distributed on the potential of the barriers. Even though the
transmission of the particles through graphene superlattice with white noise
potentials is suppressed, the transmission is revived in a wide range of angles
when the potential heights are long-range correlated with a power spectrum
. As a result, the conductance increases with increasing
the correlation exponent values gives rise a metallic phase. We obtain a phase
transition diagram in which a critical correlation exponent depends strongly on
disorder strength and slightly on the energy of the incident particles. The
phase transition, on the other hand, appears in all ranges of the energy from
propagating to evanescent mode regimes.Comment: 8 pages, 11 figure
Zur Ressourcenproduktivität von spurgeführten Hochgeschwindigkeitsverkehrssystemen: Ein Vergleich von ICE und Transrapid. Eine gemeinsame Studie des Lehrstuhls für Technikwirkungs- und Innovationsforschung der Universität GH Kassel und des Wuppertal-Instituts
- …
